STX12,STX13,STX14
  • STX12,STX13,STX14

Anti-STX12 Antibody 100ul

Ref: AN-HPA055300-100ul
Anti-STX12

Información del producto

Polyclonal Antibody against Human STX12, Gene description: syntaxin 12, Alternative Gene Names: STX13, STX14, Validated applications: ICC, WB, Uniprot ID: Q86Y82, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STX12
Gene Description syntaxin 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence KERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERET
Immunogen KERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERET
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names STX13, STX14
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86Y82
HTS Code 3002150000
Gene ID 23673
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STX12 Antibody 100ul

Anti-STX12 Antibody 100ul