ARHGEF9,KIAA0424
  • ARHGEF9,KIAA0424

Anti-ARHGEF9 Antibody 100ul

Ref: AN-HPA055291-100ul
Anti-ARHGEF9

Información del producto

Polyclonal Antibody against Human ARHGEF9, Gene description: Cdc42 guanine nucleotide exchange factor (GEF) 9, Alternative Gene Names: KIAA0424, PEM-2, Validated applications: ICC, Uniprot ID: O43307, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARHGEF9
Gene Description Cdc42 guanine nucleotide exchange factor (GEF) 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Immunogen VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0424, PEM-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43307
HTS Code 3002150000
Gene ID 23229
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGEF9 Antibody 100ul

Anti-ARHGEF9 Antibody 100ul