YIF1B,FinGER8
  • YIF1B,FinGER8

Anti-YIF1B Antibody 100ul

Ref: AN-HPA055257-100ul
Anti-YIF1B

Información del producto

Polyclonal Antibody against Human YIF1B, Gene description: Yip1 interacting factor homolog B (S. cerevisiae), Alternative Gene Names: FinGER8, Validated applications: IHC, WB, Uniprot ID: Q5BJH7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name YIF1B
Gene Description Yip1 interacting factor homolog B (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence HQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITK
Immunogen HQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FinGER8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5BJH7
HTS Code 3002150000
Gene ID 90522
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-YIF1B Antibody 100ul

Anti-YIF1B Antibody 100ul