ASB4,ASB-4
  • ASB4,ASB-4

Anti-ASB4 Antibody 100ul

Ref: AN-HPA055240-100ul
Anti-ASB4

Información del producto

Polyclonal Antibody against Human ASB4, Gene description: ankyrin repeat and SOCS box containing 4, Alternative Gene Names: ASB-4, Validated applications: IHC, Uniprot ID: Q9Y574, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ASB4
Gene Description ankyrin repeat and SOCS box containing 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEH
Immunogen VWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ASB-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y574
HTS Code 3002150000
Gene ID 51666
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ASB4 Antibody 100ul

Anti-ASB4 Antibody 100ul