GADD45GIP1,CKBBP2
  • GADD45GIP1,CKBBP2

Anti-GADD45GIP1 Antibody 25ul

Ref: AN-HPA055205-25ul
Anti-GADD45GIP1

Información del producto

Polyclonal Antibody against Human GADD45GIP1, Gene description: growth arrest and DNA-damage-inducible, gamma interacting protein 1, Alternative Gene Names: CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6, Validated applications: ICC, Uniprot ID: Q8TAE8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GADD45GIP1
Gene Description growth arrest and DNA-damage-inducible, gamma interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Immunogen ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TAE8
HTS Code 3002150000
Gene ID 90480
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GADD45GIP1 Antibody 25ul

Anti-GADD45GIP1 Antibody 25ul