ARHGAP35,GRF-1
  • ARHGAP35,GRF-1

Anti-ARHGAP35 Antibody 25ul

Ref: AN-HPA055184-25ul
Anti-ARHGAP35

Información del producto

Polyclonal Antibody against Human ARHGAP35, Gene description: Rho GTPase activating protein 35, Alternative Gene Names: GRF-1, GRLF1, KIAA1722, P190A, p190ARhoGAP, p190RhoGAP, Validated applications: IHC, WB, Uniprot ID: Q9NRY4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARHGAP35
Gene Description Rho GTPase activating protein 35
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LVALTDGAVDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
Immunogen LVALTDGAVDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GRF-1, GRLF1, KIAA1722, P190A, p190ARhoGAP, p190RhoGAP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRY4
HTS Code 3002150000
Gene ID 2909
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGAP35 Antibody 25ul

Anti-ARHGAP35 Antibody 25ul