ORAI2,C7orf19
  • ORAI2,C7orf19

Anti-ORAI2 Antibody 25ul

Ref: AN-HPA055137-25ul
Anti-ORAI2

Información del producto

Polyclonal Antibody against Human ORAI2, Gene description: ORAI calcium release-activated calcium modulator 2, Alternative Gene Names: C7orf19, CBCIP2, FLJ12474, FLJ14733, H_NH0514P08.8, TMEM142B, Validated applications: ICC, Uniprot ID: Q96SN7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ORAI2
Gene Description ORAI calcium release-activated calcium modulator 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
Immunogen MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C7orf19, CBCIP2, FLJ12474, FLJ14733, H_NH0514P08.8, TMEM142B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96SN7
HTS Code 3002150000
Gene ID 80228
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ORAI2 Antibody 25ul

Anti-ORAI2 Antibody 25ul