GPR162,A-2,GRCA
  • GPR162,A-2,GRCA

Anti-GPR162 Antibody 100ul

Ref: AN-HPA055135-100ul
Anti-GPR162

Información del producto

Polyclonal Antibody against Human GPR162, Gene description: G protein-coupled receptor 162, Alternative Gene Names: A-2, GRCA, Validated applications: ICC, IHC, WB, Uniprot ID: Q16538, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GPR162
Gene Description G protein-coupled receptor 162
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL
Immunogen KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A-2, GRCA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16538
HTS Code 3002150000
Gene ID 27239
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GPR162 Antibody 100ul

Anti-GPR162 Antibody 100ul