TACSTD2,EGP-1
  • TACSTD2,EGP-1

Anti-TACSTD2 Antibody 100ul

Ref: AN-HPA055067-100ul
Anti-TACSTD2

Información del producto

Polyclonal Antibody against Human TACSTD2, Gene description: tumor-associated calcium signal transducer 2, Alternative Gene Names: EGP-1, GA733-1, M1S1, TROP2, Validated applications: ICC, IHC, WB, Uniprot ID: P09758, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TACSTD2
Gene Description tumor-associated calcium signal transducer 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL
Immunogen AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EGP-1, GA733-1, M1S1, TROP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09758
HTS Code 3002150000
Gene ID 4070
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TACSTD2 Antibody 100ul

Anti-TACSTD2 Antibody 100ul