GID8,bA305P22.1
  • GID8,bA305P22.1

Anti-GID8 Antibody 25ul

Ref: AN-HPA055047-25ul
Anti-GID8

Información del producto

Polyclonal Antibody against Human GID8, Gene description: GID complex subunit 8, Alternative Gene Names: bA305P22.1, C20orf11, FLJ20602, TWA1, Validated applications: ICC, Uniprot ID: Q9NWU2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GID8
Gene Description GID complex subunit 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
Immunogen FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA305P22.1, C20orf11, FLJ20602, TWA1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWU2
HTS Code 3002150000
Gene ID 54994
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GID8 Antibody 25ul

Anti-GID8 Antibody 25ul