PPP1R1C
  • PPP1R1C

Anti-PPP1R1C Antibody 25ul

Ref: AN-HPA055043-25ul
Anti-PPP1R1C

Información del producto

Polyclonal Antibody against Human PPP1R1C, Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 1C, Alternative Gene Names: Inhibitor-1-like, Validated applications: ICC, Uniprot ID: Q8WVI7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP1R1C
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 1C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
Immunogen PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Inhibitor-1-like
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVI7
HTS Code 3002150000
Gene ID 151242
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP1R1C Antibody 25ul

Anti-PPP1R1C Antibody 25ul