DCAF17,C2orf37
  • DCAF17,C2orf37

Anti-DCAF17 Antibody 100ul

Ref: AN-HPA055040-100ul
Anti-DCAF17

Información del producto

Polyclonal Antibody against Human DCAF17, Gene description: DDB1 and CUL4 associated factor 17, Alternative Gene Names: C2orf37, FLJ13096, Validated applications: ICC, IHC, Uniprot ID: Q5H9S7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCAF17
Gene Description DDB1 and CUL4 associated factor 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD
Immunogen EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf37, FLJ13096
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5H9S7
HTS Code 3002150000
Gene ID 80067
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DCAF17 Antibody 100ul

Anti-DCAF17 Antibody 100ul