NABP1,DKFZp667M1322
  • NABP1,DKFZp667M1322

Anti-NABP1 Antibody 100ul

Ref: AN-HPA054978-100ul
Anti-NABP1

Información del producto

Polyclonal Antibody against Human NABP1, Gene description: nucleic acid binding protein 1, Alternative Gene Names: DKFZp667M1322, FLJ13624, FLJ22833, hSSB2, MGC111163, OBFC2A, SOSS-B2, SSB2, Validated applications: ICC, Uniprot ID: Q96AH0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NABP1
Gene Description nucleic acid binding protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK
Immunogen EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp667M1322, FLJ13624, FLJ22833, hSSB2, MGC111163, OBFC2A, SOSS-B2, SSB2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96AH0
HTS Code 3002150000
Gene ID 64859
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NABP1 Antibody 100ul

Anti-NABP1 Antibody 100ul