TNFSF10,Apo-2L
  • TNFSF10,Apo-2L

Anti-TNFSF10 Antibody 100ul

Ref: AN-HPA054938-100ul
Anti-TNFSF10

Información del producto

Polyclonal Antibody against Human TNFSF10, Gene description: tumor necrosis factor (ligand) superfamily, member 10, Alternative Gene Names: Apo-2L, CD253, TL2, TRAIL, Validated applications: ICC, IHC, Uniprot ID: P50591, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNFSF10
Gene Description tumor necrosis factor (ligand) superfamily, member 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS
Immunogen GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Apo-2L, CD253, TL2, TRAIL
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P50591
HTS Code 3002150000
Gene ID 8743
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNFSF10 Antibody 100ul

Anti-TNFSF10 Antibody 100ul