C2orf81,hCG40743
  • C2orf81,hCG40743

Anti-C2orf81 Antibody 100ul

Ref: AN-HPA054835-100ul
Anti-C2orf81

Información del producto

Polyclonal Antibody against Human C2orf81, Gene description: chromosome 2 open reading frame 81, Alternative Gene Names: hCG40743, LOC388963, Validated applications: IHC, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C2orf81
Gene Description chromosome 2 open reading frame 81
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PGGPVEEADGQSRGLSSAGSLSASFQLSVEEAPADDADPSLDPYLVASPQASTGRGHPLGFHLSLEDLYCCMPQLDAAGDRLELRSEGVPCIASGVLVSYPS
Immunogen PGGPVEEADGQSRGLSSAGSLSASFQLSVEEAPADDADPSLDPYLVASPQASTGRGHPLGFHLSLEDLYCCMPQLDAAGDRLELRSEGVPCIASGVLVSYPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hCG40743, LOC388963
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 388963
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C2orf81 Antibody 100ul

Anti-C2orf81 Antibody 100ul