FOSB,AP-1
  • FOSB,AP-1

Anti-FOSB Antibody 25ul

Ref: AN-HPA054663-25ul
Anti-FOSB

Información del producto

Polyclonal Antibody against Human FOSB, Gene description: FBJ murine osteosarcoma viral oncogene homolog B, Alternative Gene Names: AP-1, DKFZp686C0818, G0S3, GOS3, GOSB, MGC42291, Validated applications: ICC, Uniprot ID: P53539, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FOSB
Gene Description FBJ murine osteosarcoma viral oncogene homolog B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF
Immunogen LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP-1, DKFZp686C0818, G0S3, GOS3, GOSB, MGC42291
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P53539
HTS Code 3002150000
Gene ID 2354
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FOSB Antibody 25ul

Anti-FOSB Antibody 25ul