MAPK12,ERK6
  • MAPK12,ERK6

Anti-MAPK12 Antibody 100ul

Ref: AN-HPA054562-100ul
Anti-MAPK12

Información del producto

Polyclonal Antibody against Human MAPK12, Gene description: mitogen-activated protein kinase 12, Alternative Gene Names: ERK6, p38gamma, PRKM12, SAPK-3, SAPK3, Validated applications: IHC, WB, Uniprot ID: P53778, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAPK12
Gene Description mitogen-activated protein kinase 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
Immunogen FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERK6, p38gamma, PRKM12, SAPK-3, SAPK3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P53778
HTS Code 3002150000
Gene ID 6300
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAPK12 Antibody 100ul

Anti-MAPK12 Antibody 100ul