ST8SIA2,HsT19690
  • ST8SIA2,HsT19690

Anti-ST8SIA2 Antibody 25ul

Ref: AN-HPA054518-25ul
Anti-ST8SIA2

Información del producto

Polyclonal Antibody against Human ST8SIA2, Gene description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, Alternative Gene Names: HsT19690, SIAT8B, ST8SIA-II, STX, Validated applications: ICC, IHC, WB, Uniprot ID: Q92186, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ST8SIA2
Gene Description ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE
Immunogen SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HsT19690, SIAT8B, ST8SIA-II, STX
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92186
HTS Code 3002150000
Gene ID 8128
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ST8SIA2 Antibody 25ul

Anti-ST8SIA2 Antibody 25ul