CRISP3,Aeg2,CRISP-3
  • CRISP3,Aeg2,CRISP-3

Anti-CRISP3 Antibody 25ul

Ref: AN-HPA054392-25ul
Anti-CRISP3

Información del producto

Polyclonal Antibody against Human CRISP3, Gene description: cysteine-rich secretory protein 3, Alternative Gene Names: Aeg2, CRISP-3, CRS3, dJ442L6.3, SGP28, Validated applications: IHC, WB, Uniprot ID: P54108, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CRISP3
Gene Description cysteine-rich secretory protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNS
Immunogen SCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Aeg2, CRISP-3, CRS3, dJ442L6.3, SGP28
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P54108
HTS Code 3002150000
Gene ID 10321
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CRISP3 Antibody 25ul

Anti-CRISP3 Antibody 25ul