TDRD10,DKFZp434M202
  • TDRD10,DKFZp434M202

Anti-TDRD10 Antibody 25ul

Ref: AN-HPA054327-25ul
Anti-TDRD10

Información del producto

Polyclonal Antibody against Human TDRD10, Gene description: tudor domain containing 10, Alternative Gene Names: DKFZp434M202, Validated applications: ICC, Uniprot ID: Q5VZ19, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TDRD10
Gene Description tudor domain containing 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VMFIDFGQLATIPVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLAVVPPLL
Immunogen VMFIDFGQLATIPVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLAVVPPLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434M202
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VZ19
HTS Code 3002150000
Gene ID 126668
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TDRD10 Antibody 25ul

Anti-TDRD10 Antibody 25ul