NTPCR,C1orf57
  • NTPCR,C1orf57

Anti-NTPCR Antibody 25ul

Ref: AN-HPA054304-25ul
Anti-NTPCR

Información del producto

Polyclonal Antibody against Human NTPCR, Gene description: nucleoside-triphosphatase, cancer-related, Alternative Gene Names: C1orf57, HCR-NTPase, MGC13186, Validated applications: ICC, IHC, Uniprot ID: Q9BSD7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NTPCR
Gene Description nucleoside-triphosphatase, cancer-related
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
Immunogen PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf57, HCR-NTPase, MGC13186
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BSD7
HTS Code 3002150000
Gene ID 84284
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NTPCR Antibody 25ul

Anti-NTPCR Antibody 25ul