SEC16B,LZTR2
  • SEC16B,LZTR2

Anti-SEC16B Antibody 100ul

Ref: AN-HPA054292-100ul
Anti-SEC16B

Información del producto

Polyclonal Antibody against Human SEC16B, Gene description: SEC16 homolog B, endoplasmic reticulum export factor, Alternative Gene Names: LZTR2, PGPR-p117, RGPR, Sec16S, Validated applications: ICC, Uniprot ID: Q96JE7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEC16B
Gene Description SEC16 homolog B, endoplasmic reticulum export factor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
Immunogen SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LZTR2, PGPR-p117, RGPR, Sec16S
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JE7
HTS Code 3002150000
Gene ID 89866
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SEC16B Antibody 100ul

Anti-SEC16B Antibody 100ul