NME7,CFAP67
  • NME7,CFAP67

Anti-NME7 Antibody 25ul

Ref: AN-HPA054289-25ul
Anti-NME7

Información del producto

Polyclonal Antibody against Human NME7, Gene description: NME/NM23 family member 7, Alternative Gene Names: CFAP67, FLJ37194, NM23-H7, Validated applications: ICC, Uniprot ID: Q9Y5B8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NME7
Gene Description NME/NM23 family member 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN
Immunogen SIRALFGTDGIRNAAHGPDSFASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CFAP67, FLJ37194, NM23-H7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5B8
HTS Code 3002150000
Gene ID 29922
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NME7 Antibody 25ul

Anti-NME7 Antibody 25ul