KLHL11,FLJ10572
  • KLHL11,FLJ10572

Anti-KLHL11 Antibody 100ul

Ref: AN-HPA054269-100ul
Anti-KLHL11

Información del producto

Polyclonal Antibody against Human KLHL11, Gene description: kelch-like family member 11, Alternative Gene Names: FLJ10572, Validated applications: IHC, WB, Uniprot ID: Q9NVR0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLHL11
Gene Description kelch-like family member 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
Immunogen NSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVRIPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10572
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NVR0
HTS Code 3002150000
Gene ID 55175
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLHL11 Antibody 100ul

Anti-KLHL11 Antibody 100ul