ZNF106,SH3BP3
  • ZNF106,SH3BP3

Anti-ZNF106 Antibody 100ul

Ref: AN-HPA054267-100ul
Anti-ZNF106

Información del producto

Polyclonal Antibody against Human ZNF106, Gene description: zinc finger protein 106, Alternative Gene Names: SH3BP3, ZFP106, ZNF474, Validated applications: ICC, IHC, Uniprot ID: Q9H2Y7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF106
Gene Description zinc finger protein 106
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDWNHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSVRSTNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSEGFTSD
Immunogen RSGWHKGVAGGSSTWFHNHSNSGGGWLSNSGAVDWNHNGTGRNSSWLSEGTGGFSSWHMNNSNGNWKSSVRSTNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNWQRQENDKLGTVATYRGPSEGFTSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SH3BP3, ZFP106, ZNF474
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2Y7
HTS Code 3002150000
Gene ID 64397
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF106 Antibody 100ul

Anti-ZNF106 Antibody 100ul