E2F4,E2F-4
  • E2F4,E2F-4

Anti-E2F4 Antibody 100ul

Ref: AN-HPA054128-100ul
Anti-E2F4

Información del producto

Polyclonal Antibody against Human E2F4, Gene description: E2F transcription factor 4, p107/p130-binding, Alternative Gene Names: E2F-4, Validated applications: ICC, Uniprot ID: Q16254, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name E2F4
Gene Description E2F transcription factor 4, p107/p130-binding
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD
Immunogen GPNPSTSFEPIKADPTGVLELPKELSEIFDPTRECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names E2F-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16254
HTS Code 3002150000
Gene ID 1874
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-E2F4 Antibody 100ul

Anti-E2F4 Antibody 100ul