LY75,CD205,CLEC13B
  • LY75,CD205,CLEC13B

Anti-LY75 Antibody 25ul

Ref: AN-HPA054073-25ul
Anti-LY75

Información del producto

Polyclonal Antibody against Human LY75, Gene description: lymphocyte antigen 75, Alternative Gene Names: CD205, CLEC13B, DEC-205, Validated applications: ICC, Uniprot ID: O60449, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LY75
Gene Description lymphocyte antigen 75
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
Immunogen QRHRLHLAGFSSVRYAQGVNEDEIMLPSFH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD205, CLEC13B, DEC-205
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60449
HTS Code 3002150000
Gene ID 4065
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LY75 Antibody 25ul

Anti-LY75 Antibody 25ul