PRR5,FLJ20185k
  • PRR5,FLJ20185k

Anti-PRR5 Antibody 25ul

Ref: AN-HPA054072-25ul
Anti-PRR5

Información del producto

Polyclonal Antibody against Human PRR5, Gene description: proline rich 5 (renal), Alternative Gene Names: FLJ20185k, PP610, Protor-1, Validated applications: IHC, Uniprot ID: P85299, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PRR5
Gene Description proline rich 5 (renal)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTR
Immunogen AKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPGQGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20185k, PP610, Protor-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P85299
HTS Code 3002150000
Gene ID 55615
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PRR5 Antibody 25ul

Anti-PRR5 Antibody 25ul