TM2D3,BLP2,FLJ22604
  • TM2D3,BLP2,FLJ22604

Anti-TM2D3 Antibody 100ul

Ref: AN-HPA054064-100ul
Anti-TM2D3

Información del producto

Polyclonal Antibody against Human TM2D3, Gene description: TM2 domain containing 3, Alternative Gene Names: BLP2, FLJ22604, Validated applications: ICC, IHC, Uniprot ID: Q9BRN9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TM2D3
Gene Description TM2 domain containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC
Immunogen IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BLP2, FLJ22604
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRN9
HTS Code 3002150000
Gene ID 80213
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TM2D3 Antibody 100ul

Anti-TM2D3 Antibody 100ul