ZP3,ZP3-372,ZP3-424
  • ZP3,ZP3-372,ZP3-424

Anti-ZP3 Antibody 25ul

Ref: AN-HPA054061-25ul
Anti-ZP3

Información del producto

Polyclonal Antibody against Human ZP3, Gene description: zona pellucida glycoprotein 3 (sperm receptor), Alternative Gene Names: ZP3-372, ZP3-424, ZP3A, ZP3B, ZPC, Validated applications: IHC, Uniprot ID: P21754, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZP3
Gene Description zona pellucida glycoprotein 3 (sperm receptor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTD
Immunogen QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZP3-372, ZP3-424, ZP3A, ZP3B, ZPC
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P21754
HTS Code 3002150000
Gene ID 7784
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZP3 Antibody 25ul

Anti-ZP3 Antibody 25ul