PTPRK,R-PTP-kappa
  • PTPRK,R-PTP-kappa

Anti-PTPRK Antibody 100ul

Ref: AN-HPA054056-100ul
Anti-PTPRK

Información del producto

Polyclonal Antibody against Human PTPRK, Gene description: protein tyrosine phosphatase, receptor type, K, Alternative Gene Names: R-PTP-kappa, Validated applications: ICC, Uniprot ID: Q15262, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PTPRK
Gene Description protein tyrosine phosphatase, receptor type, K
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM
Immunogen QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names R-PTP-kappa
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15262
HTS Code 3002150000
Gene ID 5796
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PTPRK Antibody 100ul

Anti-PTPRK Antibody 100ul