HMCN2,DKFZp434P0216
  • HMCN2,DKFZp434P0216

Anti-HMCN2 Antibody 25ul

Ref: AN-HPA053903-25ul
Anti-HMCN2

Información del producto

Polyclonal Antibody against Human HMCN2, Gene description: hemicentin 2, Alternative Gene Names: DKFZp434P0216, FLJ23816, Validated applications: ICC, IHC, Uniprot ID: Q8NDA2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HMCN2
Gene Description hemicentin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence FSTQPLLDLNHTLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHE
Immunogen FSTQPLLDLNHTLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434P0216, FLJ23816
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NDA2
HTS Code 3002150000
Gene ID 256158
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HMCN2 Antibody 25ul

Anti-HMCN2 Antibody 25ul