ORC3,IMAGE50150
  • ORC3,IMAGE50150

Anti-ORC3 Antibody 25ul

Ref: AN-HPA053748-25ul
Anti-ORC3

Información del producto

Polyclonal Antibody against Human ORC3, Gene description: origin recognition complex, subunit 3, Alternative Gene Names: IMAGE50150, LATHEO, ORC3L, Validated applications: IHC, Uniprot ID: Q9UBD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ORC3
Gene Description origin recognition complex, subunit 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD
Immunogen NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IMAGE50150, LATHEO, ORC3L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBD5
HTS Code 3002150000
Gene ID 23595
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ORC3 Antibody 25ul

Anti-ORC3 Antibody 25ul