SLA2,C20orf156
  • SLA2,C20orf156

Anti-SLA2 Antibody 100ul

Ref: AN-HPA053746-100ul
Anti-SLA2

Información del producto

Polyclonal Antibody against Human SLA2, Gene description: Src-like-adaptor 2, Alternative Gene Names: C20orf156, FLJ21992, SLAP-2, Validated applications: ICC, Uniprot ID: Q9H6Q3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLA2
Gene Description Src-like-adaptor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG
Immunogen GPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf156, FLJ21992, SLAP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H6Q3
HTS Code 3002150000
Gene ID 84174
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLA2 Antibody 100ul

Anti-SLA2 Antibody 100ul