SGF29,CCDC101
  • SGF29,CCDC101

Anti-SGF29 Antibody 25ul

Ref: AN-HPA053608-25ul
Anti-SGF29

Información del producto

Polyclonal Antibody against Human SGF29, Gene description: SAGA complex associated factor 29, Alternative Gene Names: CCDC101, FLJ32446, TDRD29, Validated applications: IHC, Uniprot ID: Q96ES7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SGF29
Gene Description SAGA complex associated factor 29
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN
Immunogen RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCDC101, FLJ32446, TDRD29
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96ES7
HTS Code 3002150000
Gene ID 112869
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SGF29 Antibody 25ul

Anti-SGF29 Antibody 25ul