WDR54,FLJ12953
  • WDR54,FLJ12953

Anti-WDR54 Antibody 25ul

Ref: AN-HPA053558-25ul
Anti-WDR54

Información del producto

Polyclonal Antibody against Human WDR54, Gene description: WD repeat domain 54, Alternative Gene Names: FLJ12953, Validated applications: ICC, IHC, Uniprot ID: Q9H977, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDR54
Gene Description WD repeat domain 54
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TTGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECVADTQLCGARFCDSSGNSFAVTGYDL
Immunogen TTGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECVADTQLCGARFCDSSGNSFAVTGYDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12953
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H977
HTS Code 3002150000
Gene ID 84058
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR54 Antibody 25ul

Anti-WDR54 Antibody 25ul