CLHC1,C2orf63
  • CLHC1,C2orf63

Anti-CLHC1 Antibody 25ul

Ref: AN-HPA053557-25ul
Anti-CLHC1

Información del producto

Polyclonal Antibody against Human CLHC1, Gene description: clathrin heavy chain linker domain containing 1, Alternative Gene Names: C2orf63, FLJ31438, Validated applications: ICC, Uniprot ID: Q8NHS4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CLHC1
Gene Description clathrin heavy chain linker domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQE
Immunogen EIMLHYIERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHAFPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf63, FLJ31438
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NHS4
HTS Code 3002150000
Gene ID 130162
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CLHC1 Antibody 25ul

Anti-CLHC1 Antibody 25ul