TJP3,ZO-3
  • TJP3,ZO-3

Anti-TJP3 Antibody 25ul

Ref: AN-HPA053337-25ul
Anti-TJP3

Información del producto

Polyclonal Antibody against Human TJP3, Gene description: tight junction protein 3, Alternative Gene Names: ZO-3, Validated applications: ICC, IHC, WB, Uniprot ID: O95049, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TJP3
Gene Description tight junction protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS
Immunogen VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZO-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95049
HTS Code 3002150000
Gene ID 27134
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TJP3 Antibody 25ul

Anti-TJP3 Antibody 25ul