UQCRQ,QCR8,QP-C
  • UQCRQ,QCR8,QP-C

Anti-UQCRQ Antibody 25ul

Ref: AN-HPA053323-25ul
Anti-UQCRQ

Información del producto

Polyclonal Antibody against Human UQCRQ, Gene description: ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa, Alternative Gene Names: QCR8, QP-C, UQCR7, Validated applications: ICC, Uniprot ID: O14949, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UQCRQ
Gene Description ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
Immunogen IRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names QCR8, QP-C, UQCR7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14949
HTS Code 3002150000
Gene ID 27089
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UQCRQ Antibody 25ul

Anti-UQCRQ Antibody 25ul