RAD21L1,dJ545L17.2
  • RAD21L1,dJ545L17.2

Anti-RAD21L1 Antibody 100ul

Ref: AN-HPA053282-100ul
Anti-RAD21L1

Información del producto

Polyclonal Antibody against Human RAD21L1, Gene description: RAD21-like 1 (S. pombe), Alternative Gene Names: dJ545L17.2, RAD21L, Validated applications: IHC, Uniprot ID: Q9H4I0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAD21L1
Gene Description RAD21-like 1 (S. pombe)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KRGGVHTLLSTAAQDLIHAELKMLFTKCFLSSGFKLGRKMIQKESVREEVGNQNIVETSMMQEPNYQQELSKPQTWKDVIG
Immunogen KRGGVHTLLSTAAQDLIHAELKMLFTKCFLSSGFKLGRKMIQKESVREEVGNQNIVETSMMQEPNYQQELSKPQTWKDVIG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names dJ545L17.2, RAD21L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4I0
HTS Code 3002150000
Gene ID 642636
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAD21L1 Antibody 100ul

Anti-RAD21L1 Antibody 100ul