HLA-DRA,HLA-DRA1
  • HLA-DRA,HLA-DRA1

Anti-HLA-DRA Antibody 100ul

Ref: AN-HPA053176-100ul
Anti-HLA-DRA

Información del producto

Polyclonal Antibody against Human HLA-DRA, Gene description: major histocompatibility complex, class II, DR alpha, Alternative Gene Names: HLA-DRA1, Validated applications: IHC, Uniprot ID: P01903, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HLA-DRA
Gene Description major histocompatibility complex, class II, DR alpha
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK
Immunogen AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HLA-DRA1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P01903
HTS Code 3002150000
Gene ID 3122
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HLA-DRA Antibody 100ul

Anti-HLA-DRA Antibody 100ul