TCL1B,TML1
  • TCL1B,TML1

Anti-TCL1B Antibody 25ul

Ref: AN-HPA053163-25ul
Anti-TCL1B

Información del producto

Polyclonal Antibody against Human TCL1B, Gene description: T-cell leukemia/lymphoma 1B, Alternative Gene Names: TML1, Validated applications: ICC, IHC, WB, Uniprot ID: O95988, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCL1B
Gene Description T-cell leukemia/lymphoma 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Immunogen WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TML1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95988
HTS Code 3002150000
Gene ID 9623
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TCL1B Antibody 25ul

Anti-TCL1B Antibody 25ul