CCNL2,ania-6b,CCNM
  • CCNL2,ania-6b,CCNM

Anti-CCNL2 Antibody 25ul

Ref: AN-HPA053137-25ul
Anti-CCNL2

Información del producto

Polyclonal Antibody against Human CCNL2, Gene description: cyclin L2, Alternative Gene Names: ania-6b, CCNM, CCNS, HLA-ISO, PCEE, SB138, Validated applications: ICC, IHC, Uniprot ID: Q96S94, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCNL2
Gene Description cyclin L2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
Immunogen DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ania-6b, CCNM, CCNS, HLA-ISO, PCEE, SB138
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96S94
HTS Code 3002150000
Gene ID 81669
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCNL2 Antibody 25ul

Anti-CCNL2 Antibody 25ul