CELSR1,ADGRC1,CDHF9
  • CELSR1,ADGRC1,CDHF9

Anti-CELSR1 Antibody 100ul

Ref: AN-HPA052976-100ul
Anti-CELSR1

Información del producto

Polyclonal Antibody against Human CELSR1, Gene description: cadherin, EGF LAG seven-pass G-type receptor 1, Alternative Gene Names: ADGRC1, CDHF9, FMI2, HFMI2, ME2, Validated applications: ICC, Uniprot ID: Q9NYQ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CELSR1
Gene Description cadherin, EGF LAG seven-pass G-type receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV
Immunogen PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADGRC1, CDHF9, FMI2, HFMI2, ME2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NYQ6
HTS Code 3002150000
Gene ID 9620
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CELSR1 Antibody 100ul

Anti-CELSR1 Antibody 100ul