DFFB,CAD,CPAN
  • DFFB,CAD,CPAN

Anti-DFFB Antibody 100ul

Ref: AN-HPA052904-100ul
Anti-DFFB

Información del producto

Polyclonal Antibody against Human DFFB, Gene description: DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase), Alternative Gene Names: CAD, CPAN, DFF-40, DFF40, Validated applications: ICC, Uniprot ID: O76075, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DFFB
Gene Description DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
Immunogen EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAD, CPAN, DFF-40, DFF40
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O76075
HTS Code 3002150000
Gene ID 1677
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DFFB Antibody 100ul

Anti-DFFB Antibody 100ul