CCDC69,DKFZP434C171
  • CCDC69,DKFZP434C171

Anti-CCDC69 Antibody 25ul

Ref: AN-HPA052896-25ul
Anti-CCDC69

Información del producto

Polyclonal Antibody against Human CCDC69, Gene description: coiled-coil domain containing 69, Alternative Gene Names: DKFZP434C171, FLJ13705, Validated applications: ICC, WB, Uniprot ID: A6NI79, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCDC69
Gene Description coiled-coil domain containing 69
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence EPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRA
Immunogen EPHELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEEKKKWAQQVEKERELELRDRLDEQQRVLEGKNEEALQVLRA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434C171, FLJ13705
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6NI79
HTS Code 3002150000
Gene ID 26112
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC69 Antibody 25ul

Anti-CCDC69 Antibody 25ul