TEX40,C11orf20
  • TEX40,C11orf20

Anti-TEX40 Antibody 25ul

Ref: AN-HPA052822-25ul
Anti-TEX40

Información del producto

Polyclonal Antibody against Human TEX40, Gene description: testis expressed 40, Alternative Gene Names: C11orf20, DKFZP566E164, Validated applications: ICC, Uniprot ID: Q9NTU4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TEX40
Gene Description testis expressed 40
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence HRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
Immunogen HRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf20, DKFZP566E164
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NTU4
HTS Code 3002150000
Gene ID 25858
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TEX40 Antibody 25ul

Anti-TEX40 Antibody 25ul