C22orf46
  • C22orf46

Anti-C22orf46 Antibody 100ul

Ref: AN-HPA052741-100ul
Anti-C22orf46

Información del producto

Polyclonal Antibody against Human C22orf46, Gene description: chromosome 22 open reading frame 46, Alternative Gene Names: CTA-216E10.6, FLJ23584, Validated applications: ICC, IHC, Uniprot ID: C9J442, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C22orf46
Gene Description chromosome 22 open reading frame 46
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVISVRSRPTSMTLTTSLPNL
Immunogen VHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVISVRSRPTSMTLTTSLPNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CTA-216E10.6, FLJ23584
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID C9J442
HTS Code 3002150000
Gene ID 79640
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C22orf46 Antibody 100ul

Anti-C22orf46 Antibody 100ul