ZNF878
  • ZNF878

Anti-ZNF878 Antibody 100ul

Ref: AN-HPA052735-100ul
Anti-ZNF878

Información del producto

Polyclonal Antibody against Human ZNF878, Gene description: zinc finger protein 878, Validated applications: ICC, IHC, Uniprot ID: C9JN71, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF878
Gene Description zinc finger protein 878
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIHGR
Immunogen TPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIHGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID C9JN71
HTS Code 3002150000
Gene ID 729747
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF878 Antibody 100ul

Anti-ZNF878 Antibody 100ul