MZB1,HSPC190,MEDA-7
  • MZB1,HSPC190,MEDA-7

Anti-MZB1 Antibody 100ul

Ref: AN-HPA052694-100ul
Anti-MZB1

Información del producto

Polyclonal Antibody against Human MZB1, Gene description: marginal zone B and B1 cell-specific protein, Alternative Gene Names: HSPC190, MEDA-7, MGC29506, PACAP, pERp1, Validated applications: IHC, WB, Uniprot ID: Q8WU39, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MZB1
Gene Description marginal zone B and B1 cell-specific protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS
Immunogen TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC190, MEDA-7, MGC29506, PACAP, pERp1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WU39
HTS Code 3002150000
Gene ID 51237
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MZB1 Antibody 100ul

Anti-MZB1 Antibody 100ul